PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G023900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 392aa    MW: 43697.6 Da    PI: 7.6181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G023900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-173885148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
  Manes.17G023900.1.p 38 RGLWTAEEDAKILAYVSSHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 85
                         788*******************************************97 PP

2Myb_DNA-binding49.11.3e-1593134346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +T++E++l+++++k  G++ W++Iar ++ gRt++++k++w++
  Manes.17G023900.1.p  93 DFTPQEEQLIINLHKAVGSR-WSLIARQLP-GRTDNDVKNYWNT 134
                          69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-242988IPR009057Homeodomain-like
PROSITE profilePS5129425.6293389IPR017930Myb domain
SuperFamilySSF466891.52E-3035132IPR009057Homeodomain-like
SMARTSM007175.1E-143787IPR001005SANT/Myb domain
PfamPF002497.7E-153885IPR001005SANT/Myb domain
CDDcd001671.87E-114185No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2489140IPR009057Homeodomain-like
SMARTSM007176.2E-1590138IPR001005SANT/Myb domain
PROSITE profilePS5129419.13290140IPR017930Myb domain
PfamPF002498.9E-1493134IPR001005SANT/Myb domain
CDDcd001671.42E-1194136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MYLQQRLQLS SPLLHNPFSF CFLPMGRPPC CDKSNVKRGL WTAEEDAKIL AYVSSHGIGN  60
WTLVPKKAGL NRCGKSCRLR WTNYLRPDLK HDDFTPQEEQ LIINLHKAVG SRWSLIARQL  120
PGRTDNDVKN YWNTKLKKKL SKMGIDPITH KSFSQILSEY GNIRGISNNN GNHVASFNKN  180
FNSTLVSKPE QPSSSVLTGP SSSNVILKPP IEQVHENSFI NNSHSWEFLP QFQVTNHDIL  240
KPYLFNEVSS SSSSSCSSTA TQLNSPQSYT CQESQPPLTP SSSCFWSEFL VNDPVISADF  300
HHLQQQQQHQ DSHGVLSSTS ISTQNNIFHG KFTSGNGDFG PYDHGVMNGN QTNSYADASS  360
SSASSFVDGI LDKDREMGSQ FPQLLDPSFD Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29381407108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015573637.11e-157PREDICTED: transcription factor MYB35
TrEMBLA0A061EFX61e-134A0A061EFX6_THECC; Duplicated homeodomain-like superfamily protein, putative
STRINGVIT_14s0066g02180.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.16e-77MYB family protein